PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g20150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family BES1
Protein Properties Length: 309aa    MW: 33306.4 Da    PI: 9.4368
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g20150genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822218.91.1e-6791451134
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                 g+++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc eAGw+ve+DGttyrkg++p+  +e++g+sa+++p+ss + s+ 
  CA04g20150   9 GSGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCVEAGWIVEPDGTTYRKGCRPT-PMEIGGTSANITPSSSRNPSPP 106
                 6899************************************************************************.********************** PP

      DUF822 100 ssalaspvesysaspksssfpspssldsislasa....a 134
                 ss++asp++sy++sp+sssfpsp++ d ++++++    +
  CA04g20150 107 SSYFASPIPSYQPSPTSSSFPSPTRGDANMSSHPfaflH 145
                 ***************************998876544432 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.1E-6210138IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGSGGVGGGS GRRKPSWRER ENNRRRERRR RAIAAKIYAG LRAQGNYNLP KHCDNNEVLK  60
ALCVEAGWIV EPDGTTYRKG CRPTPMEIGG TSANITPSSS RNPSPPSSYF ASPIPSYQPS  120
PTSSSFPSPT RGDANMSSHP FAFLHNSIPL SLPSLRISNS APVTPPLSSP TRVPKQIFNL  180
ETLARESMSA LNIPFFAASA PASPTRGQRF TPATIPECDE SDSSTIDSGH WMSFQKYAAN  240
GVPTSPTFNL IMPAAQRIPS NDMIIDKGKG IEFDFENVSV KAGWEGEKIH EVGLEDLELT  300
LGSGSARM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11130RRKPSWRERENNRRRERRRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568620.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-120BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLK4BV771e-179K4BV77_SOLLC; Uncharacterized protein
STRINGSolyc04g079980.2.11e-178(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.23e-90BES1 family protein